1.67 Rating by CuteStat

coolmando.com is 8 years 8 months old. It is a domain having com extension. This website is estimated worth of $ 8.95 and have a daily income of around $ 0.15. As no active threats were reported recently by users, coolmando.com is SAFE to browse.

PageSpeed Score
88
Siteadvisor Rating
Not Applicable

Traffic Report

Daily Unique Visitors: Not Applicable
Daily Pageviews: Not Applicable

Estimated Valuation

Income Per Day: $ 0.15
Estimated Worth: $ 8.95

Search Engine Indexes

Google Indexed Pages: Not Applicable
Bing Indexed Pages: Not Applicable

Search Engine Backlinks

Google Backlinks: Not Applicable
Bing Backlinks: Not Applicable

Safety Information

Google Safe Browsing: No Risk Issues
Siteadvisor Rating: Not Applicable
WOT Trustworthiness: Not Applicable
WOT Child Safety: Not Applicable

Website Ranks & Scores

Alexa Rank: Not Applicable
Domain Authority: Not Applicable

Web Server Information

Hosted IP Address:

184.175.95.2

Hosted Country:

United States of America US

Location Latitude:

38.6312

Location Longitude:

-90.1922
Armando Luna - Technology Consultant | websites, hosting, custom software, promotional material

Page Resources Breakdown

Homepage Links Analysis

Website Inpage Analysis

H1 Headings: Not Applicable H2 Headings: Not Applicable
H3 Headings: Not Applicable H4 Headings: Not Applicable
H5 Headings: Not Applicable H6 Headings: Not Applicable
Total IFRAMEs: Not Applicable Total Images: 1
Google Adsense: Not Applicable Google Analytics: Not Applicable

Websites Hosted on Same IP (i.e. 184.175.95.2)

Family Law Attorney Services : Johnson Law

- familylawlawyerfayettevillenc.com

Johnson law practices family law in Wilmington, NC. We handle cases that consist of child custody to divorces.

Not Applicable $ 8.95

Grandfamilies

- cssgrandfamilies.org
Not Applicable $ 8.95

403 Forbidden

- familylawattorneyfayettevillenc.com
Not Applicable $ 8.95

Error Occurred While Processing Request

- testosteronetherapyschertz.com
Not Applicable $ 8.95

Levitation Staging

- levquote.com
Not Applicable $ 8.95

HTTP Header Analysis

HTTP/1.1 200 OK
Date: Wed, 26 Aug 2015 09:32:09 GMT
Server: Apache mod_fcgid/2.3.9 mod_jk/1.2.37
Connection: close
Transfer-Encoding: chunked
Content-Type: text/html;charset=UTF-8

Domain Information

Domain Registrar: GoDaddy.com LLC
Registration Date: Aug 19, 2015, 12:00 AM 8 years 8 months 5 days ago
Last Modified: Aug 19, 2015, 12:00 AM 8 years 8 months 5 days ago
Expiration Date: Aug 19, 2017, 12:00 AM 6 years 8 months 1 week ago
Domain Status:
clientDeleteProhibited
clientRenewProhibited
clientTransferProhibited
clientUpdateProhibited

Domain Nameserver Information

Host IP Address Country
ns3.hostek.com 173.245.58.12 United States of America United States of America
ns4.hostek.com 173.245.59.13 United States of America United States of America

DNS Record Analysis

Host Type TTL Extra
coolmando.com A 14396 IP: 184.175.95.2
coolmando.com NS 21599 Target: ns3.hostek.com
coolmando.com NS 21599 Target: ns4.hostek.com
coolmando.com SOA 21599 MNAME: ns3.hostek.com
RNAME: cpanel.hostek.com
Serial: 2015081903
Refresh: 86400
Retry: 7200
Expire: 3600000
Minimum TTL: 86400
coolmando.com MX 14399 Target: coolmando.com

Full WHOIS Lookup

Domain Name: COOLMANDO.COM
Registrar URL: http://www.godaddy.com
Registrant Name: Armando Luna
Registrant Organization:
Name Server: NS3.HOSTEK.COM
Name Server: NS4.HOSTEK.COM
DNSSEC: unsigned

For complete domain details go to:
http://who.godaddy.com/whoischeck.aspx?domain=COOLMANDO.COM

The data contained in GoDaddy.com, LLC's WhoIs database,
while believed by the company to be reliable, is provided "as is"
with no guarantee or warranties regarding its accuracy. This
information is provided for the sole purpose of assisting you
in obtaining information about domain name registration records.
Any use of this data for any other purpose is expressly forbidden without the prior written
permission of GoDaddy.com, LLC. By submitting an inquiry,
you agree to these terms of usage and limitations of warranty. In particular,
you agree not to use this data to allow, enable, or otherwise make possible,
dissemination or collection of this data, in part or in its entirety, for any
purpose, such as the transmission of unsolicited advertising and
and solicitations of any kind, including spam. You further agree
not to use this data to enable high volume, automated or robotic electronic
processes designed to collect or compile this data for any purpose,
including mining this data for your own personal or commercial purposes.

Please note: the registrant of the domain name is specified
in the "registrant" section. In most cases, GoDaddy.com, LLC
is not the registrant of domain names listed in this database.